Loading...
Statistics
Advertisement

Sycmy.com.cn

Advertisement
Sycmy.com.cn is hosted in China / Haerbin . Sycmy.com.cn doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: IIS.

Technologies in use by Sycmy.com.cn

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • IIS

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Sycmy.com.cn

Missing HTTPS protocol.

    Meta - Sycmy.com.cn

    Number of occurences: 1
    • Name:
      Content: Close

    Server / Hosting

    • IP: 222.171.249.207
    • Latitude: 45.75
    • Longitude: 126.65
    • Country: China
    • City: Haerbin

    Rname

    • f1g1ns2.dnspod.net
    • f1g1ns1.dnspod.net
    • sx207.lcweb03.cn

    Target

    • freednsadmin.dnspod.com

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: no-store Date: Wed, 25 May 2016 22:02:35 GMT Pragma: no-cache Content-Length: 405 Content-Type: text/html; Charset=gb2312 Server: IIS X-Cache: MISS from s_hk1 X-Cache-Lookup: MISS from s_hk1:80 Via: 1.1 s_hk1 (squid/3.5.9) Connection: keep-alive

    DNS

    host: sx207.lcweb03.cn
    1. class: IN
    2. ttl: 580
    3. type: A
    4. ip: 222.171.249.207
    host: sycmy.com.cn
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns2.dnspod.net
    host: sycmy.com.cn
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: f1g1ns1.dnspod.net
    host: sycmy.com.cn
    1. class: IN
    2. ttl: 600
    3. type: CNAME
    4. target: sx207.lcweb03.cn
    host: sycmy.com.cn
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: f1g1ns1.dnspod.net
    5. rname: freednsadmin.dnspod.com
    6. serial: 1452859947
    7. refresh: 3600
    8. retry: 180
    9. expire: 1209600
    10. minimum-ttl: 180

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ycmy.com.cn, www.seycmy.com.cn, www.eycmy.com.cn, www.swycmy.com.cn, www.wycmy.com.cn, www.sdycmy.com.cn, www.dycmy.com.cn, www.sxycmy.com.cn, www.xycmy.com.cn, www.sfycmy.com.cn, www.fycmy.com.cn, www.sgycmy.com.cn, www.gycmy.com.cn, www.stycmy.com.cn, www.tycmy.com.cn, www.scmy.com.cn, www.syzcmy.com.cn, www.szcmy.com.cn, www.syacmy.com.cn, www.sacmy.com.cn, www.syscmy.com.cn, www.sscmy.com.cn, www.sydcmy.com.cn, www.sdcmy.com.cn, www.sycmy.com.cn, www.scmy.com.cn, www.syccmy.com.cn, www.sccmy.com.cn, www.sy cmy.com.cn, www.s cmy.com.cn, www.symy.com.cn, www.sycdmy.com.cn, www.sydmy.com.cn, www.sycrmy.com.cn, www.syrmy.com.cn, www.syctmy.com.cn, www.sytmy.com.cn, www.sycvmy.com.cn, www.syvmy.com.cn, www.sycfmy.com.cn, www.syfmy.com.cn, www.sycgmy.com.cn, www.sygmy.com.cn, www.sychmy.com.cn, www.syhmy.com.cn, www.sycnmy.com.cn, www.synmy.com.cn, www.sycmmy.com.cn, www.symmy.com.cn, www.sycjmy.com.cn, www.syjmy.com.cn, www.sycy.com.cn, www.sycmpy.com.cn, www.sycpy.com.cn, www.sycmoy.com.cn, www.sycoy.com.cn, www.sycmiy.com.cn, www.syciy.com.cn, www.sycmky.com.cn, www.sycky.com.cn, www.sycm.y.com.cn, www.syc.y.com.cn, www.sycmuy.com.cn, www.sycuy.com.cn, www.sycmjy.com.cn, www.sycjy.com.cn, www.sycmny.com.cn, www.sycny.com.cn, www.sycm-y.com.cn, www.syc-y.com.cn, www.sycm.com.cn, www.sycmyz.com.cn, www.sycmz.com.cn, www.sycmya.com.cn, www.sycma.com.cn, www.sycmys.com.cn, www.sycms.com.cn, www.sycmyd.com.cn, www.sycmd.com.cn, www.sycmy.com.cn, www.sycm.com.cn, www.sycmyc.com.cn, www.sycmc.com.cn, www.sycmy .com.cn, www.sycm .com.cn,

    Other websites we recently analyzed

    1. xiaochayuan.cn
      China - 124.16.31.152
      Server software: Tengine/1.4.2
      Technology: Google Adsense, Html, Javascript, Php
      Number of Javascript: 2
      Number of meta tags: 1
    2. privateyewear.com
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    3. Eva voss
      Much more organized. Although I am young I am recently married and a few medical assistant night jobs I want to start a family. Bonus Three How to Overcome Test Anxiety- Do you get really nervous the day before important tests? You def make enough to pay it.
      Saint Louis (United States) - 173.237.137.45
      Server software: nginx
      Technology: CSS, Flexslider, Html, Html5, Wordpress
      Number of Javascript: 5
      Number of meta tags: 6
    4. SHEDLOCK | Auto Care Specialists
      Sshedlock Auto Care Specialists in Warren NJ
      Toronto (Canada) - 216.107.18.2
      Server software: nginx
      Technology: CSS, Html
      Number of meta tags: 3
    5. Newgotiate • Untertitel
      Germany - 134.119.45.44
      Server software: Apache/2.4.10
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 4
      Number of meta tags: 3
    6. Benteng Mas Perkasa - Master Dealer of Grundfos Pumps
      Master Dealer / Distributor Pompa Air Grundfos Jakarta / Jabodetabek, kami telah berpengalaman lebih dari 20 tahun di bidang plumbing.
      Chicago (United States) - 50.31.162.83
      Server software: Apache
      Technology: CSS, Font Awesome, Html, Html5, Javascript, Php, Zopim Live Chat, Google Analytics, Joomla, Virtuemart, Facebook Box
      Number of Javascript: 18
      Number of meta tags: 6
    7. FrancineHuot.com
      Welcome to FrancineHuot.com. Bienvenue sur le site FrancineHuot.com
      Scottsdale (United States) - 50.62.160.219
      G Analytics ID: UA-58256132-1
      Server software: Microsoft-IIS/8.0
      Technology: CSS, Html, Html5, Php, Google Analytics
      Number of Javascript: 1
      Number of meta tags: 2
    8. Ronni Jolles | Painting With Paper Artist
      “Painting with paper” is the best way to express what I do. Paper – in its multitude of colors and textures – is the essence of my work, and subjects come into
      Culver City (United States) - 205.186.183.143
      Server software: Sun-ONE-Web-Server/6.1
      Technology: CSS, Html, Html5, Javascript, SVG, Google Analytics, Wordpress
      Number of Javascript: 9
      Number of meta tags: 4
    9. Siamexim - Thiết bị nhà bếp cao cấp
      Công ty chuyên nhập khẩu và phân phối độc quyền thiết bị nhà bếp, đồ gia dụng cao cấp Thái Lan.
      United States - 31.220.110.35
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, jQuery UI, Php, Facebook Box
      Number of Javascript: 10
      Number of meta tags: 4
    10. risperdaltardivedyskinesialawsuit.com
      Albuquerque (United States) - 129.121.40.24
      Server software: nginx
      Technology: Html
      Number of meta tags: 1

    Check Other Websites